PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3284s0019.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 369aa    MW: 40427.4 Da    PI: 9.1384
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3284s0019.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.4e-3976137263
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                          ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+sss
  Araha.3284s0019.1.p  76 PQEKLNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSS 137
                          6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2575125IPR003851Zinc finger, Dof-type
PfamPF027016.2E-3378134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.90180134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009416Biological Processresponse to light stimulus
GO:0009845Biological Processseed germination
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MDATKWTQGF QEMMNVKPME QIMIPNNNTH QSNTTSNARP NTILTSNGVS SAGATVSGVS  60
NNNNNTAVVA ERKARPQEKL NCPRCNSTNT KFCYYNNYSL TQPRYFCKGC RRYWTEGGSL  120
RNVPVGGSSR KNKRSSSSNI LQTTPSSLGL TTTLPDLNPP ILFSNQIHNK SKGSSQDLNL  180
LSFPVMQDQH QHHVHMSQFL QMPKMEGNGN ITHQQQPSSS SSLYGSSSSP VSALELLRTG  240
VNVSARSGIN SFMPSGSMMD SNTVLYTSSG FPTMVDYKPS NLSFSTDHQG LGHNSNNRSE  300
ALHNDHHQQG RVLFPFGDQM KELSSSITQE VDHDDNQQQK SHGNNNNSSP NNGYWTGMFS  360
TTGGGSSW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00319DAPTransfer from AT2G46590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2378110.0AJ237811.1 Arabidopsis thaliana mRNA for putative DNA binding protein (partial).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880253.10.0hypothetical protein ARALYDRAFT_904128
SwissprotQ9ZPY00.0DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLD7LF650.0D7LF65_ARALL; Putative uncharacterized protein
STRINGscaffold_403629.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46590.21e-167Dof family protein